Anti-KLHL15 Antibody (A283814)

Anti-KLHL15 Antibody

Rabbit polyclonal antibody to KLHL15.

This antibody recognises kelch-like protein 15, also known as KIAA1677, Epididymis Secretory Sperm Binding Protein, and HEL-S-305. KLHL15 is a substrate-specific adaptor for CUL3-based E3 ubiquitin ligases, and is critical for governing the activity of CtIP for DNA-end resection and pathway choice for repair of double-strand DNA breaks.

WB: 1:500 - 1:2,000

Human, Rat, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human Keyhole Limpet HaemocyaninL15 (NP_085127.2).

MAGDVEGFCSSIHDTSVSAGFRALYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMFTADMRERDQDKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFCCSFLLAKICLENCAEIMRLLDDFGVNIEGVREKLDTFLLDNFVPLMSRPDFLSYLSFEKLMSYLDNDHLSRFPEIELYEAVQSWLRHDRRRWRHTDTIIQNIRFCLMTPTSVFEKVKTSEFYRYSRQLRYEVDQALNYFQNVHQQPLLDMKSSRIRSAKPQTTVFRGMIGHSMVNSKILL

Rabbit

Polyclonal

IgG

Lot Specific

Liquid

Supplied in Phosphate Buffered Saline with 0.05% ProClin 300 and 50% Glycerol.

Store undiluted at -20°C. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Rabbit anti KLHL15 antibody recognizes kelch-like protein 15, also known as KIAA1677, Epididymis Secretory Sperm Binding Protein, and HEL-S-305. KLHL15 is a substrate-specific adaptor for CUL3-based E3 ubiquitin ligases, and is critical for governing the activity of CtIP for DNA-end resection and pathway choice for repair of double-strand DNA breaks (Ferretti et al. 2016).

Kelch-like protein 15, KIAA1677