Anti-LAMTOR4 Antibody [EF01-1D8] (A320301)

Anti-LAMTOR4 Antibody [EF01-1D8]

Mouse monoclonal [EF01-1D8] antibody to LAMTOR4.

This antibody recognises the Ragulator complex protein LAMTOR4, also known as C7orf59.LAMTOR4 is a part of the Ragulator complex, which is an important regulator of cell metabolism and growth via the activation of the mTOR complex-1 pathway. Deregulation within the mTORC1 pathway can be seen to result in conditions such as cancer, obesity and type 2 diabetes. The Ragulator complex in line with heterodimeric GTPases and the v-ATPase form a system that is used as an amino acid sensing system by mTORC1 (Bar-Peled & Sabatiniet al. 2014).

WB: 1:1,000

Human, Mouse, Rat

E. coli derived recombinant protein corresponding to amino acids 1-99 of human LAMTOR4.

MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV

Mouse

Monoclonal

EF01-1D8

IgG2a

1 mg/ml

12 kDa in LNCaP cell lysates

Liquid

Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti human LAMTOR4, clone EF01-1D8 recognizes the Ragulator complex protein LAMTOR4, also known as C7orf59.LAMTOR4 is a part of the Ragulator complex, which is an important regulator of cell metabolism and growth via the activation of the mTOR complex-1 pathway. (Bar-Peled et al. 2012). Deregulation within the mTORC1 pathway can be seen to result in conditions such as cancer, obesity and type 2 diabetes. The Ragulator complex in line with heterodimeric GTPases and the v-ATPase form a system that is used as an amino acid sensing system by mTORC1 (Bar-Peled & Sabatiniet al. 2014).

C7orf59, Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4, Ragulator complex protein LAMTOR4