Anti-MALT1 / MLT Antibody [50] (A278748)

Anti-MALT1 / MLT Antibody [50]

Mouse monoclonal [50] antibody to MALT1 / MLT.

This antibody recognises human mucosal-associated lymphoid tissue lymphoma translocation 1 (MALT1), also known as MALT lymphoma-associated translocation and paracaspase. MALT1 is an 824 amino acid ~93 kDa protein belonging to the peptidase C14B family containing a single death domain and two Ig-like CD-type domains. In normal lymphocytes, MALT1 plays an important role in antigen receptor-mediated lymphocyte activation. In T-cells, MALT1 is recruited by activated CARMA1, along with Bcl-10, to form a CARMA1-Bcl10-MALT1 (CBM) complex which is involved in the activation of NF-kappaB. MALT1 was initially identified as a recurrent translocation t(11;18)(q21:q21) in mucosal-associated lymphomas , which creates a functional fusion oncoprotein consisting of MALT1 and apoptosis inhibitor API2. Overexpression of MALT1, or expression of the API2-MALT1 fusion protein, leads to the uncontrolled activation of NF-kappaB which is stimulus-independent. recognises both MALT1 and the MALT1-API2 fusion protein.

WB, IHC-P

Human

Recombinant protein corresponding to amino acids 701-808 located within the C-terminus of MALT1.

DKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETT

Mouse

Monoclonal

50

IgG1

Protein G affinity chromatography of tissue culture supernatant.

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human MALT1 antibody, clone 50 recognizes human mucosal-associated lymphoid tissue lymphoma translocation 1 (MALT1), also known as MALT lymphoma-associated translocation and paracaspase. MALT1 is an 824 amino acid ~93 kDa protein belonging to the peptidase C14B family containing a single death domain and two Ig-like CD-type domains. In normal lymphocytes, MALT1 plays an important role in antigen receptor-mediated lymphocyte activation. In T-cells, MALT1 is recruited by activated CARMA1, along with Bcl-10, to form a CARMA1-Bcl10-MALT1 (CBM) complex which is involved in the activation of NF-kappaB (Yang et al. 2013).MALT1 was initially identified as a recurrent translocation t(11;18)(q21:q21) in mucosal-associated lymphomas (Horsman et al. 1992), which creates a functional fusion oncoprotein consisting of MALT1 and apoptosis inhibitor API2 (Dierlamm et al. 1999). Overexpression of MALT1, or expression of the API2-MALT1 fusion protein, leads to the uncontrolled activation of NF-kappaB which is stimulus-independent. (Zhou et al. 2005) Mouse anti Human MALT1 recognizes both MALT1 and the MALT1-API2 fusion protein (Murga Penas et al. 2007).