Anti-MYOZ1 Antibody (A92179)

Anti-MYOZ1 Antibody

Rabbit polyclonal antibody to MYOZ1.

WB: 1:500-1:2000

Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 180-299 of human MYOZ1 (NP_067068.1).

VFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEEL

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Calsarcin-2, Filamin-, actinin- and telethonin-binding protein, MYOZ, Myozenin-1, Protein FATZ