Anti-OR51E1 Antibody (A91585)

Anti-OR51E1 Antibody

Rabbit polyclonal antibody to OR51E1.

WB: 1:500-1:2000

Human

A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human OR51E1 (NP_689643.2).

VYGLIVIISAIGLDSLLISFSYLLILKTVLGLTREAQAKAFGTCVSHVCAVFIFYVPFIGLSMVHRFSKRRDSPLPVILANIYLLVPPVLNPIVYGVKTKEIRQRILRLFHVATHASEP

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

D-GPCR, G-protein coupled receptor 164, GPR164, Olfactory receptor 51E1, Olfactory receptor 52A3, OR51E1P, OR52A3P, POGR, Prostate-overexpressed G protein-coupled receptor, Prostate-specific G protein-coupled receptor 2, PSGR2