Anti-Osteoprotegerin Antibody [E01-10F11] (A280283)

Anti-Osteoprotegerin Antibody [E01-10F11]

Mouse monoclonal [E01-10F11] antibody to Osteoprotegerin.

This antibody recognises osteoprotegerin (OPG), a cytokine receptor and member of the tumour necrosis factor (TNF) receptor superfamily. The role of OPG involves it acting as a decoy receptor for the ligand of CD254 and thereby preventing its function in osteoclastogenesis. In addition to this it may act as a decoy receptor for TNF related apoptosis inducing ligand (TRAIL) (Emery et al. 1998 and Schoppet et al. 2002). The combination of these two roles allows OPG to inhibit NFkB’s regulatory effects on inflammation, skeletal, and vascular systems.OPG is highly expressed in a wide range of tissues, including adult heart, lung, liver, prostate, ovary and bone marrow. More recently a role for OPG in cardiovascular disease has emerged and it is now clinically relevant biomarker of vascular health (Bierre, 2013).

WB, ELISA

WB: 1:1,000

Human

E. coli derived recombinant protein corresponding to amino acids 22-201 of human osteoprotegerin.

ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTL

Mouse

Monoclonal

E01-10F11

IgG1

Protein G affinity chromatography of ascites.

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human osteoprotegerin, clone E01-10F11, recognizes osteoprotegerin (OPG), a cytokine receptor and member of the tumour necrosis factor (TNF) receptor superfamily. The role of OPG involves it acting as a decoy receptor for the ligand of CD254 and thereby preventing its function in osteoclastogenesis. In addition to this it may act as a decoy receptor for TNF related apoptosis inducing ligand (TRAIL) (Emery et al. 1998 and Schoppet et al. 2002). The combination of these two roles allows OPG to inhibit NFkB’s regulatory effects on inflammation, skeletal, and vascular systems.OPG is highly expressed in a wide range of tissues, including adult heart, lung, liver, prostate, ovary and bone marrow. More recently a role for OPG in cardiovascular disease has emerged and it is now clinically relevant biomarker of vascular health (Bierre, 2013).

OCIF, OPG, Osteoclastogenesis inhibitory factor, TNFRSF11B, Tumor necrosis factor receptor superfamily member 11B