ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Anti-Parathyroid Hormone Antibody [BGN/1F8] (A279829)

$525

Mouse monoclonal [BGN/1F8] antibody to Parathyroid Hormone for ELISA, IHC-Fr and IHC-P.

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 5-7 business days.
Name
Anti-Parathyroid Hormone Antibody [BGN/1F8]
Description
Mouse monoclonal [BGN/1F8] antibody to Parathyroid Hormone.
Specificity
This antibody recognises human parathyroid hormone (PTH) also known as Parathyrin. PTH is a hormone produced by the parathyroid gland responsible for the regulation of calcium and phosphorus concentrations in extracellular fluid (Brown 1983).Human parathyroid hormone is produced in the parathyroid gland as a 115 amino acid single chain polypeptide, bearing a 25 amino acid signal peptide, a 6 amino acid pro-peptide sequence and an 84 amino acid mature hormone. Defects in the PTH gene are a cause of familial isolated hypoparathyroidism (FIH), a condition characterized by hypocalcemia and hyperphosphatemia owing to levels of parathyroid hormone being insufficient to maintain extracellular calcium concentrations within normal parameters. Clinical features of FIH include cramps, seizures and tetany. More rarely, hypoparathyroidism like disease, Pseudohypothyroidism (PHP1A) may be caused by mutations in the GNAS gene or defects in the PTHR1 gene (Cohen 2002) leading to Jansen metaphyseal chondrodysplasia (JMC), conditions where end organ resistance to PTH function exists.
Applications
ELISA, IHC-Fr, IHC-P
Dilutions
ELISA: 1:2 000 - 1:20 000
Reactivity
Human, Rat, Mouse
Immunogen
Synthetic peptide corresponding to amino acids 1-34 of mature PTH conjugated to a proprietary carrier molecule.
Sequence
MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVS
Host
Mouse
Clonality
Monoclonal
Clone ID
BGN/1F8
Isotype
IgG1
Conjugate

Unconjugated

Purification
Protein A affinity chromatography of tissue culture supernatant.
Concentration
1 mg/ml
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.
Storage
Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.
General Notes
Mouse anti Human parathyroid hormone monoclonal antibody, clone BGN/1F8 recognizes human parathyroid hormone (PTH) also known as Parathyrin. PTH is a hormone produced by the parathyroid gland responsible for the regulation of calcium and phosphorus concentrations in extracellular fluid (Brown 1983).Human parathyroid hormone is produced in the parathyroid gland as a 115 amino acid single chain polypeptide, bearing a 25 amino acid signal peptide, a 6 amino acid pro-peptide sequence and an 84 amino acid mature hormone. (Keutmann et al. 1978).Defects in the PTH gene are a cause of familial isolated hypoparathyroidism (FIH), a condition characterized by hypocalcemia and hyperphosphatemia owing to levels of parathyroid hormone being insufficient to maintain extracellular calcium concentrations within normal parameters. Clinical features of FIH include cramps, seizures and tetany (Arnold et al. 1990). More rarely, hypoparathyroidism like disease, Pseudohypothyroidism (PHP1A) may be caused by mutations in the GNAS gene (Mantovani & Spada 2006) or defects in the PTHR1 gene (Cohen 2002) leading to Jansen metaphyseal chondrodysplasia (JMC), conditions where end organ resistance to PTH function exists .
Synonyms
Parathormone, Parathyrin, PTH
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Anti-Parathyroid Hormone Antibody [BGN/1F8] (A279829)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Parathyroid Hormone Antibody [BGN/1F8] (A279829)

Proteins predicted to interact with Parathyroid Hormone

Predicted protein interactions based upon String database. Revelancy score correlates with probability of interaction.
99.9% Relevancy Score
99.9% Relevancy Score
97.6% Relevancy Score
97.5% Relevancy Score
97.5% Relevancy Score
95.1% Relevancy Score
94.1% Relevancy Score
93.1% Relevancy Score
91.1% Relevancy Score