Anti-PKD1 Antibody (A92390)

Anti-PKD1 Antibody

Rabbit polyclonal antibody to PKD1.

WB: 1:500-1:2000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 3700-3860 of human PKD1 (NP_001009944.2).

RLQSAIKQELHSRAFLAITRSEELWPWMAHVLLPYVHGNQSSPELGPPRLRQVRLQEALYPDPPGPRVHTCSAAGGFSTSDYDVGWESPHNGSGTWAYSAPDLLGAWSWGSCAVYDSGGYVQELGLSLEESRDRLRFLQLHNWLDNRSRAVFLELTRYSPA

Rabbit

Polyclonal

IgG

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Autosomal dominant polycystic kidney disease 1 protein, Autosomal dominant polycystic kidney disease protein 1, nPKC-D1, nPKC-mu, OTTHUMP00000208669, OTTHUMP00000208670, PBP, Pc-1, PKD, PKD1_HUMAN, Polycystic Kidney Disease 1, polycystic kidney disease-associated protein, Polycystin 1, Polycystin 1 Precursor, Polycystin-1, Protein kinase C mu type, Protein kinase D, Serine/threonine-protein kinase D1, transient receptor potential cation channel, subfamily P, member 1, TRPP1