Anti-PRR5L Antibody [EF01-3H1] (A320303)

Anti-PRR5L Antibody [EF01-3H1]

Mouse monoclonal [EF01-3H1] antibody to PRR5L.

This antibody recognises Proline-rich protein 5-like, also known as PROTOR2.The PRR5L protein is associated with the mTORC2 pathway, which is involved in the regulation of certain cellular process. These include the organization and maintenance of the cytoskeleton.

WB: 1:1,000

Human, Mouse

E. coli derived recombinant protein corresponding to amino acids 1-368 of human PRR5L.

MTRGFAPILPVEFHKMGSFRRPRPRFMSSPVLSDLPRFQAARQALQLSSSSAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQLLAKGLFFVEEKIKLCEGENRIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDLLLLAQSKLPSSIVQMLLILQSVHEPTGPSESYLQLEELVKQVVSPFLGISGDRSFSGPTYTLARRHSRVRPKVTVLNYASPITAVSRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEEASSENKCLLLPPSFPPPHRQCSSEPNITDNPDGLEEGARGSQEGSELNCASLS

Mouse

Monoclonal

EF01-3H1

IgG2a

Protein G affinity chromatography of tissue culture supernatant.

1 mg/ml

46 kDa in HepG2 cell lysates

Liquid

Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti human PRR5L, clone EF01-3H1 recognizes Proline-rich protein 5-like, also known as PROTOR2.The PRR5L protein is associated with the mTORC2 pathway, which is involved in the regulation of certain cellular process. These include the organization and maintenance of the cytoskeleton (Pearce et al. 2007).

Proline-rich protein 5-like, Protein observed with Rictor-2, PROTOR2