Anti-RECQL4 Antibody (A92275)

Anti-RECQL4 Antibody

Rabbit polyclonal antibody to RECQL4.

WB: 1:500-1:2000

Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 231-330 of human RECQL4 (NP_004251.3).

GAGSQGPEASAFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPGEPVQAQPPQPCSSPSNPRYHGLSPSSQARA

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ATP-dependent DNA helicase Q4, DNA 3'-5' helicase RecQ4, DNA helicase, RecQ-like type 4, RecQ protein-like 4, RECQ4, RTS