Anti-SARS-CoV Nucleoprotein Antibody [3851] (A278810)

Anti-SARS-CoV Nucleoprotein Antibody [3851]

Mouse monoclonal [3851] antibody to SARS-CoV Nucleoprotein.

This antibody recognises nucleoprotein, also known as nucleocapsid protein and Protein N. The nucleoprotein (N) is the most abundant viral protein in SARS-CoV-infected cells. It is one of the four structural proteins essential for viral assembly, alongside the spike (S), envelope (E), and membrane (M) proteins. The nucleoprotein encloses the viral genome; during assembly of the virion, nucleoprotein binds to viral RNA and forms the helical nucleocapsid. It appears to be a multifunctional protein, and plays an important role in enhancing viral transcription and assembly. The N protein of a range of coronaviruses are abundantly expressed and are highly immunogenic, and high concentrations of anti-nucleoprotein IgG antibodies have been detected in patients with SARS. These properties have made the nucleoprotein of SARS-CoV-2 a target of interest for developing a vaccine against COVID-19.

WB, ELISA

ELISA: 1 µg/ml, WB: 1 µg/ml

Viral

Recombinant fragment amino acids 1-49 of the SARS nucleoprotein.

MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN

Mouse

Monoclonal

3851

IgG2b

Protein A affinity chromatography.

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti SARS-CoV nucleoprotein antibody recognizes nucleoprotein, also known as nucleocapsid protein and Protein N. The nucleoprotein (N) is the most abundant viral protein in SARS-CoV-infected cells (Chang et al. 2014). It is one of the four structural proteins essential for viral assembly, alongside the spike (S), envelope (E), and membrane (M) proteins (Bartlam et al. 2005). The nucleoprotein encloses the viral genome; during assembly of the virion, nucleoprotein binds to viral RNA and forms the helical nucleocapsid (Zhu et al. 2004). It appears to be a multifunctional protein, and plays an important role in enhancing viral transcription and assembly (McBride et al. 2014). The N protein of a range of coronaviruses are abundantly expressed and are highly immunogenic, and high concentrations of anti-nucleoprotein IgG antibodies have been detected in patients with SARS. These properties have made the nucleoprotein of SARS-CoV-2 a target of interest for developing a vaccine against COVID-19 (Dutta et al. 2020).