Anti-SCN2A Antibody (A8659)

Anti-SCN2A Antibody

Rabbit polyclonal antibody to SCN2A.

WB: 1:1,000-1:2,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 275-401 of human SCN2A (NP_001035232.1).

RNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTY

Rabbit

Polyclonal

IgG

Affinity purification.

250 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

HBA, HBSC II, hNaN, KIAA1356, MED, NAC2, NAC3, Peripheral nerve sodium channel 5, PN5, SCN11A, SCN12A, SCN2A1, SCN2A2, SCN3A, SCN8A, Sensory neuron sodium channel 2, SNS2, Sodium channel protein brain II subunit alpha, Sodium channel protein brain III subunit alpha, Sodium channel protein type 11 subunit alpha, Sodium channel protein type 2 subunit alpha, Sodium channel protein type 3 subunit alpha, Sodium channel protein type 8 subunit alpha, Sodium channel protein type II subunit alpha, Sodium channel protein type III subunit alpha, Sodium channel protein type VIII subunit alpha, Sodium channel protein type XI subunit alpha, Voltage-gated sodium channel subtype III, Voltage-gated sodium channel subunit alpha Nav1.2, Voltage-gated sodium channel subunit alpha Nav1.3, Voltage-gated sodium channel subunit alpha Nav1.6, Voltage-gated sodium channel subunit alpha Nav1.9