Anti-SRSF10 Antibody (A305632)

Anti-SRSF10 Antibody

Rabbit polyclonal antibody to SRSF10.

WB: 1:500-1:1,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 163-262 of human SRSF10 (NP_473357.1).

DRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH

Rabbit

Polyclonal

IgG

Lot Specific

40 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.

40 kDa SR-repressor protein, FUS-interacting serine-arginine-rich protein 1, FUSIP1, FUSIP2, Serine/arginine-rich splicing factor 10, SFRS13A, Splicing factor SRp38, Splicing factor, arginine/serine-rich 13A, SRrp40, TASR, TLS-associated protein with Ser-Arg repeats, TLS-associated protein with SR repeats, TLS-associated serine-arginine protein, TLS-associated SR protein