Anti-TAF7L Antibody (A92386)

Anti-TAF7L Antibody

Rabbit polyclonal antibody to TAF7L.

WB: 1:200-1:2000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 363-462 of human TAF7L (NP_079161.3).

SEEYLERQLQAEFIESGQYRANEGTSSIVMEIQKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK

Rabbit

Polyclonal

IgG

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Cancer/testis antigen 40, CT40, RNA polymerase II TBP-associated factor subunit Q, TAF2Q, TATA box-binding protein-associated factor 50 kDa, Transcription initiation factor TFIID 50 kDa subunit, Transcription initiation factor TFIID subunit 7-like