Anti-U2AF1L4 Antibody (A10070)

Anti-U2AF1L4 Antibody

Rabbit polyclonal antibody to U2AF1L4.

WB, IF

WB: 1:500-1:2000, IF: 1:50-1:100

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 1-202 of human U2AF1L4 (NP_659424.2).

MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSIM

Rabbit

Polyclonal

IgG

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

FLJ35525, MGC33901, Splicing factor U2AF 26 kDa subunit, U2 auxiliary factor 26, U2 small nuclear RNA auxiliary factor 1 like 3, U2 small nuclear RNA auxiliary factor 1 like 4, U2 small nuclear RNA auxiliary factor 1 like protein 3, U2 small nuclear RNA auxiliary factor 1 like protein 4, U2 small nuclear RNA auxiliary factor 1-like protein 3, U2 small nuclear RNA auxiliary factor 1-like protein 4, U2(RNU2) small nuclear RNA auxiliary factor 1 like 3, U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3, U2AF1 like protein 3, U2AF1 RS3, U2AF1-like protein 3, U2AF1L3, U2AF1L3V1, U2AF1RS3, U2af26, U2AF4_HUMAN, U2RNU2 small nuclear RNA auxiliary factor 1 like 3, U2RNU2 small nuclear RNA auxiliary factor 1 like protein 3