ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

IL 6 Human, CHO (A61513)

This product is discontinued

IL 6 Human, CHO (A61513) has been discontinued and is no longer available.

View all available products.

Name
IL 6 Human, CHO
Description
Interleukin-6 Recombinant Human, CHO
Source
Chinese Hamster Ovarian Cells.
Sequence
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity
Greater than 95.0% as determined by analysis by SDS-PAGE.
Product Form
Sterile filtered colorless solution.
Formulation
IL-6 is a sterile filtered (0.22µm) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2.
Storage
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Synonyms
Interleukin BSF 2, B cell differentiation factor , B cell stimulatory factor 2, B-cell stimulatory factor 2, BSF 2, BSF-2, BSF2, CDF, CTL differentiation factor, Cytotoxic T cell differentiation factor , Hepatocyte stimulating fact, Hepatocyte stimulating factor, Hepatocyte stimulatory factor, HGF, HPGF, HSF , Hybridoma growth factor, Hybridoma growth factor Interferon beta-2, Hybridoma plasmacytoma growth factor , IFN-beta-2, IFNB2 , IL-6, IL6, IL6 protein , IL6_HUMAN, Interferon beta 2, Interferon beta-2, Interleukin 6, Interleukin 6 (interferon beta 2) , Interleukin BSF 2, Interleukin BSF2, Interleukin-6, Interleukin6
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.