ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Recombinant Gilthead Seabream IGF1 Protein (A63088)

$125

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 5-8 business days.
Name
Recombinant Gilthead Seabream IGF1 Protein
Applications
Binding Assay
Expression System
Escherichia coli
Nature
Recombinant
Protein Species
Gilthead Seabream
Sequence
MSPETLCGAELVDTLQFVCGERGFYFSKPGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSK
Predicted MW
7,545.4 Da
Biologically Active
Yes
Biological Activity
Binding assays of the 125I-Gealthead Seabream IGF1 to Gilthead Seabream or carp (Cyprinus carpio) sera resulted in high specific binding, indicating the existence of one or more IGF-binding proteins. In binding experiments to crude Gilthead Seabream brain homogenate, using human (h) IGF-I as a ligand, the respective IC50 value of hIGF1 was about fourfold lower than that of Gilthead Seabream IGF-1. Recombinant Gilthead Seabream IGF-1 exhibited mitogenic activity in a mouse mammary gland-derived MME-L1 cell line which was approximately 200-fold lower than that of hIGF1. Binding experiments to intact MME-L1 cells suggests that this difference most likely results from a correspondingly lower affinity for IGF1 receptor in these cells. In contrast, the activities of Gilthead Seabream IGF-I and hIGF-I measured by 35S uptake by gill arches from the goldfish (Carassius auratus) were identical, indicating that the recombinant Gilthead Seabream IGF-I is biologically active.
Purity
>98% as determined by SEC-HPLC and SDS-PAGE.
Product Form
Lyophilized
Concentration
1 mg/ml
Formulation
Lyophilized from a solution containing 0.02% Sodium Bicarbonate.
Storage
Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.
Synonyms
IBP1, IGF-I, Insulin-like growth factor I, Mechano growth factor, MGF, Somatomedin-C
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Recombinant Gilthead Seabream IGF1 Protein (A63088)? Please let us know so that we can list the citation on this page.

Alternative products to Recombinant Gilthead Seabream IGF1 Protein (A63088)

Proteins predicted to interact with IGF1

Predicted protein interactions based upon String database. Revelancy score correlates with probability of interaction.
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score