ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Recombinant Human BMP4 Protein (A350283)

$440

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 4-6 business days.
Name
Recombinant Human BMP4 Protein
Description
Recombinant Human BMP4 Protein (aa 293–408) is a biologically active growth factor widely used in stem cell and developmental biology research. It supports differentiation of human embryonic stem cells into cardiomyocytes and trophoblast lineages, making it ideal for functional studies, signalling pathway analysis, and cell fate modelling. Suitable for western blotting, immunoassays, and in vitro differentiation applications.
Applications
WB, SDS-PAGE, Immunoassays, Functional Studies
Recommended Dilutions
The protein is supplied in liquid form and does not require reconstitution. For experimental use, dilute the protein in an appropriate buffer such as Phosphate Buffered Saline or cell culture media, depending on the application. For functional assays, typical working concentrations range from 10 to 50 ng/mL. In validated activity assays, BMP4 demonstrated biological activity at concentrations as low as 10–11 ng/mL, comparable to commercially available standards. Optimal dilution should be determined empirically based on the specific experimental system.
Expression System
HEK293 cells.
Protein Species
Human
Protein Length
Protein fragment.
Sequence
SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Amino Acids
293 to 408
Predicted MW
13 kDa (predicted), ~25 kDa (glycosylated).
Biologically Active
Yes
Purity
> 95% (by SDS-PAGE).
Purification
Mixed mode chromatography.
Product Form
Liquid
Concentration
Lot Specific
Formulation
Supplied in buffer with 20mM Histidine, pH 5.5, 0.2M NaCl and 0.6M Arginine.
Endotoxin Level
< 0.1 ng/µg (1 IEU/µg), as measured by LAL method.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -70°C. Avoid freeze/thaw cycles.
Synonyms
BMP-2B, BMP-4, BMP2B, Bone morphogenetic protein 2B, Bone morphogenetic protein 4, DVR4
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Recombinant Human BMP4 Protein (A350283)? Please let us know so that we can list the citation on this page.

Alternative products to Recombinant Human BMP4 Protein (A350283)

Proteins predicted to interact with BMP4

Predicted protein interactions based upon String database. Revelancy score correlates with probability of interaction.
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.3% Relevancy Score
97.8% Relevancy Score
97% Relevancy Score