ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Recombinant Human CD3 Protein (Biotin) (C-terminal His Tag) (A330297)

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.
Name
Recombinant Human CD3 Protein (Biotin) (C-terminal His Tag)
Expression System
HEK293 cells
Nature
Recombinant
Protein Species
Human
Sequence
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Tag
C-terminal His Tag
Conjugate

Biotin

Purity
>95% (by SDS-PAGE).
Product Form
Lyophilized
Concentration
Reconstitution dependent.
Formulation
Lyophilized from Phosphate Buffered Saline, pH 7.4, with 8% Trehalose (0.22µm filter sterilized).
Endotoxin Level
<1 EU/µg of the protein by LAL method.
Storage
Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles.
Synonyms
4930549J05Rik, A430104F18Rik, AW552088, Cd247, CD247 antigen, CD247 antigen, zeta subunit, CD247 molecule, CD3 antigen, delta subunit, CD3 delta, CD3 epsilon, CD3 eta, CD3 gamma, CD3 molecule delta polypeptide, CD3 molecule, epsilon polypeptide, CD3 molecule, gamma polypeptide, CD3 zeta, CD3-DELTA, CD3d, CD3D antigen delta polypeptide, CD3d antigen, delta polypeptide (TiT3 complex), CD3d molecule delta, CD3d molecule delta CD3 TCR complex, CD3d molecule, delta (CD3-TCR complex), CD3D_HUMAN, CD3E, CD3e antigen, CD3E antigen epsilon polypeptide, CD3e antigen, epsilon polypeptide (TiT3 complex), CD3e molecule epsilon, CD3e molecule epsilon CD3 TCR complex, CD3e molecule, epsilon (CD3-TCR complex), CD3epsilon, CD3G, CD3g antigen, CD3G antigen gamma polypeptide, CD3g antigen, gamma polypeptide (TiT3 complex), CD3g molecule gamma, CD3g molecule gamma CD3 TCR complex, CD3g molecule, gamma (CD3-TCR complex), CD3H, CD3Q, CD3Z, CD3zeta, Ctg3, FLJ17620, FLJ17664, FLJ18683, FLJ79544, FLJ94613, IMD19, Leu-4, MGC138597, OKT3, delta chain, OTTHUMP00000032544, T cell receptor, T cell receptor T3 delta chain, T cell receptor T3 gamma chain, T cell receptor T3 zeta chain, T cell receptor zeta chain, T cell surface glycoprotein CD3, T cell surface glycoprotein CD3 delta chain, T cell surface glycoprotein CD3 epsilon chain, T cell surface glycoprotein CD3 gamma chain, T cell surface glycoprotein CD3 zeta chain, T-cell antigen receptor complex, delta subunit of T3, T-cell antigen receptor complex, epsilon subunit of T3, T-cell antigen receptor complex, gamma subunit of T3, T-cell antigen receptor complex, zeta subunit of CD3, T-cell receptor T3 delta chain, T-cell receptor T3 gamma chain, T-cell surface antigen T3/Leu-4 epsilon chain, T-cell surface glycoprotein CD3 delta chain, T-cell surface glycoprotein CD3 gamma chain, T3, T3d, T3e, T3g, T3z, TCRE, TCRk, Tcrz, TCRzeta
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Recombinant Human CD3 Protein (Biotin) (C-terminal His Tag) (A330297)? Please let us know so that we can list the citation on this page.

Alternative products to Recombinant Human CD3 Protein (Biotin) (C-terminal His Tag) (A330297)