ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Recombinant Human FGF2 Protein (A330626)

$140

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.
Name
Recombinant Human FGF2 Protein
Expression System
Escherichia coli
Nature
Recombinant
Protein Species
Human
Sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Conjugate

Unconjugated

Biological Activity
Immobilized Human FGF2 (0.5 µg/mL) bind Human GPC3 in a functional ELISA with a linear range of 7-20 ng/mL. Cell proliferation assay using BALB/c 3T3 mouse embryonic fibroblasts: ED50 = typically 0.635-2.54 ng/mL; Specific activity =3.94 × 10^5~1.57 × 10^6 units/mg. Recombinant Human VEGFA(40 ng/mL) and bFGF (50 ng/mL) induce mesoderm cells to differentiate into hematopoietic stem and progenitor cells: pebbly-like CD43+ hematopoietic stem and progenitor cells appeared in the hematogenic endothelium after 4 days. Primary neural stem cells cultured with bFGF (20 ng/mL): particle size of the suspended neural stem cells gradually increased.
Purity
>95% (by SDS-PAGE).
Product Form
Lyophilized
Concentration
Reconstitution dependent.
Formulation
Lyophilized from 20mM Tris, pH 7.5, with 150mM Nacl (0.22µm filter sterilized).
Endotoxin Level
<1 EU/µg of the protein by LAL method.
Storage
Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles.
Synonyms
Basic fibroblast growth factor, bFGF, FGF-2, FGFB, Fibroblast growth factor 2, HBGF-2, Heparin-binding growth factor 2
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Recombinant Human FGF2 Protein (A330626)? Please let us know so that we can list the citation on this page.

Alternative products to Recombinant Human FGF2 Protein (A330626)

Proteins predicted to interact with FGF2

Predicted protein interactions based upon String database. Revelancy score correlates with probability of interaction.
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.8% Relevancy Score
99.7% Relevancy Score
99.5% Relevancy Score
99.3% Relevancy Score
99.3% Relevancy Score