Notice: Error: The total number of locks exceeds the lock table size
Error No: 1206
INSERT INTO oc_analytics set ip = '', agent = 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)', url = '/catalog/proteins-and-peptides/recombinant-human-il-3-protein-c-terminal-his-tag-a330885', route = 'product/product', port = '1581', country_code ='US', country_name='United States', city='Columbus', organisation='', referrer='', adflag='N', adcampaign='', adurl='', product_id='330885' in D:\wwwroot_antibodies\system\library\db\mysqli.php on line 42Warning: mysqli::query(): (HY000/1206): The total number of locks exceeds the lock table size in D:\wwwroot_antibodies\system\library\db\mysqli.php on line 20Notice: Error: The total number of locks exceeds the lock table size
Error No: 1206
SELECT distinct mt2.maintarget, mt2.human_uniprot, spl.protein_codeb, spl.score, spi.protein_detail, mt2.url FROM oc_maintarget mt1, oc_string_protein_links spl, oc_string_protein_info spi, oc_maintarget mt2, oc_product_description pd WHERE mt1.maintarget = 'IL-3' AND spl.protein_codea = mt1.string_protein_code AND spi.protein_code = spl.protein_codeb AND mt2.string_protein_code = spi.protein_code and pd.maintarget = mt2.maintarget and pd.category = 'Proteins and Peptides' and pd.status = 1 and pd.uk_min_price > 0 ORDER BY spl.score DESC LIMIT 9 in D:\wwwroot_antibodies\system\library\db\mysqli.php on line 42Notice: Trying to get property 'num_rows' of non-object in D:\wwwroot_antibodies\catalog2\model\catalog\product.php on line 1832 Recombinant Human IL-3 Protein (His Tag) (A330885)
ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Recombinant Human IL-3 Protein (C-terminal His Tag) (A330885)

$150

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.
Name
Recombinant Human IL-3 Protein (C-terminal His Tag)
Expression System
HEK293 cells
Nature
Recombinant
Protein Species
Human
Sequence
APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Tag
C-terminal His Tag
Conjugate

Unconjugated

Biological Activity
Inhibition of cell proliferation for TF-1 human erythroleukemic cells: ED50 = 1.5-6ng/mL.Induction of hematopoietic stem and progenitor cells to differentiate into megakaryocytes: induction of CD41/42+ megakaryocytes was successful after 6 days.
Purity
>95% (by SDS-PAGE).
Product Form
Lyophilized
Concentration
Reconstitution dependent.
Formulation
Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized).
Endotoxin Level
<1 EU/µg of the protein by LAL method.
Storage
Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles.
Synonyms
Hematopoietic growth factor, IL3, Interleukin-3, Mast cell growth factor, MCGF, Multipotential colony-stimulating factor, P-cell-stimulating factor
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Recombinant Human IL-3 Protein (C-terminal His Tag) (A330885)? Please let us know so that we can list the citation on this page.

Alternative products to Recombinant Human IL-3 Protein (C-terminal His Tag) (A330885)