Notice: Error: The total number of locks exceeds the lock table size
Error No: 1206
INSERT INTO oc_analytics set ip = '', agent = 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)', url = '/catalog/proteins-and-peptides/recombinant-human-noggin-protein-c-terminal-his-tag-a331113', route = 'product/product', port = '22425', country_code ='US', country_name='United States', city='Columbus', organisation='', referrer='', adflag='N', adcampaign='', adurl='', product_id='331113' in D:\wwwroot_antibodies\system\library\db\mysqli.php on line 42 Recombinant Human Noggin Protein (His Tag) (A331113)
ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Recombinant Human Noggin Protein (C-terminal His Tag) (A331113)

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.
Name
Recombinant Human Noggin Protein (C-terminal His Tag)
Expression System
HEK293 cells
Nature
Recombinant
Protein Species
Human
Sequence
QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Tag
C-terminal His Tag
Conjugate

Unconjugated

Biological Activity
Immobilized Human BMP2 (1 µg/mL) bind Noggin in a functional ELISA with a linear range of 2-57 ng/mL. Immobilized Human BMP4 (0.5 µg/mL) bind Noggin in a functional ELISA with a linear range of 4-47 ng/mL. Immobilized Human Noggin (1 µg/mL) bind Noggin Rabbit pAb in a functional ELISA with a linear range of 1-3.5 ng/mL. Inhibition of the BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells: ED50 = 13.28-53.12 ng/mL in the presence of 50 ng/mL of recombinant human BMP-4; Specific activity =1.88×10^4-7.53×10^4 units/mg.
Purity
>95% (by SDS-PAGE).
Product Form
Lyophilized
Concentration
Reconstitution dependent.
Formulation
Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized).
Endotoxin Level
<0.1 EU/µg of the protein by LAL method.
Storage
Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles.
Synonyms
NOG
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Recombinant Human Noggin Protein (C-terminal His Tag) (A331113)? Please let us know so that we can list the citation on this page.

Alternative products to Recombinant Human Noggin Protein (C-terminal His Tag) (A331113)

Proteins predicted to interact with Noggin

Predicted protein interactions based upon String database. Revelancy score correlates with probability of interaction.
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.7% Relevancy Score
99% Relevancy Score
98.5% Relevancy Score
97.3% Relevancy Score
94.9% Relevancy Score
93.6% Relevancy Score