Primary Antibodies
Secondary Antibodies
Proteins & Peptides
ELISA Kits
About Us
Contact Us
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0
ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Recombinant Human TGF beta Receptor I Protein (C-terminal Human Fc and His Tag) (A331318)

SDS-PAGE - Recombinant Human TGF beta Receptor I Protein (C-terminal Human Fc and His Tag) (A331318) - Antibodies.com Standard Curve - Recombinant Human TGF beta Receptor I Protein (C-terminal Human Fc and His Tag) (A331318) - Antibodies.com
$165
100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.

  • Specifications

Name
Recombinant Human TGF beta Receptor I Protein (C-terminal Human Fc and His Tag)
Expression System
HEK293 cells
Nature
Recombinant
Protein Species
Human
Sequence
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE
Tag
C-terminal Human Fc and His Tag
Conjugate

Unconjugated

Biological Activity
Immobilized Human TGF-beta Protein (2 µg/mL) bind TGFBR1 in a functional ELISA with a linear range of 3.9-80.49 ng/mL.
Purity
>95% (by SDS-PAGE).
Product Form
Lyophilized
Concentration
Reconstitution dependent.
Formulation
Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized).
Endotoxin Level
<1 EU/µg.
Storage
Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles.
Synonyms
Activin A receptor type II-like protein kinase of 53kD, Activin receptor-like kinase 5, ALK-5, ALK5, Serine/threonine-protein kinase receptor R4, SKR4, TbetaR-I, TGF-beta receptor type I, TGF-beta receptor type-1, TGF-beta type I receptor, TGFBR1, TGFR-1, Transforming growth factor-beta receptor type I
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (2)

SDS-PAGE - Recombinant Human TGF beta Receptor I Protein (C-terminal Human Fc and His Tag) (A331318) - Antibodies.comEnlarge Image

SDS-PAGE - Recombinant Human TGF beta Receptor I Protein (C-terminal Human Fc and His Tag) (A331318)

SDS-PAGE of Recombinant Human TGF beta Receptor I Protein (C-terminal Human Fc and His Tag) (A331318) using Coomassie Blue to show a band at 40-55kDa.
Standard Curve - Recombinant Human TGF beta Receptor I Protein (C-terminal Human Fc and His Tag) (A331318) - Antibodies.comEnlarge Image

Standard Curve - Recombinant Human TGF beta Receptor I Protein (C-terminal Human Fc and His Tag) (A331318)

ELISA examination of immobilized recombinant Human TGF-beta Protein (2µg/mL) binding Recombinant Human TGF beta Receptor I Protein (C-terminal Human Fc and His Tag) (A331318): linear range = 3.9-80.49ng/mL.
Publishing research using Recombinant Human TGF beta Receptor I Protein (C-terminal Human Fc and His Tag) (A331318)? Please let us know so that we can list the citation on this page.

Alternative products to Recombinant Human TGF beta Receptor I Protein (C-terminal Human Fc and His Tag) (A331318)

Proteins predicted to interact with TGF beta Receptor I

Predicted protein interactions based upon String database. Revelancy score correlates with probability of interaction.
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.8% Relevancy Score