Primary Antibodies
Secondary Antibodies
Proteins & Peptides
ELISA Kits
About Us
Contact Us
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0
ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag) (A331320)

SDS-PAGE - Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag) (A331320) - Antibodies.com Standard Curve - Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag) (A331320) - Antibodies.com
$275
Product Datasheet
100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.

  • Specifications

Name
Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag)
Expression System
HEK293 cells
Nature
Recombinant
Protein Species
Human
Sequence
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD
Tag
C-terminal Human Fc and His Tag
Conjugate

Unconjugated

Biological Activity
Immobilized recombinant human TGFB1 (2 µg/mL) bind recombinant human TGFBR2 in a functional ELISA with a linear range of 1-5 ng/mL.
Purity
>95% (by SDS-PAGE).
Product Form
Lyophilized
Concentration
Reconstitution dependent.
Formulation
Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized).
Endotoxin Level
<0.1 EU/µg of the protein by LAL method.
Storage
Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles.
Synonyms
AAT3, FAA3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TbetaR II, TbetaR-II, TGF beta receptor type 2, TGF beta receptor type II, TGF beta receptor type IIB, TGF beta type II receptor, TGF-beta receptor type II, TGF-beta receptor type-2, TGF-beta type II receptor, TGF-beta-R2, TGFB R2, TGFbeta - RII, TGFbeta RII, Tgfbr2, TGFR-2, TGFR2_HUMAN, Transforming growth factor beta receptor II, Transforming growth factor beta receptor type II, Transforming growth factor beta receptor type IIC, Transforming growth factor, beta receptor II (70/80kDa), transforming growth factor, beta receptor II alpha, transforming growth factor, beta receptor II beta, transforming growth factor, beta receptor II delta, transforming growth factor, beta receptor II epsilon, transforming growth factor, beta receptor II gamma, Transforming growth factor-beta receptor type II
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (2)

SDS-PAGE - Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag) (A331320) - Antibodies.comEnlarge Image

SDS-PAGE - Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag) (A331320)

SDS-PAGE of Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag) (A331320) using Coomassie Blue to show a band at 55-75 kDa.
Standard Curve - Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag) (A331320) - Antibodies.comEnlarge Image

Standard Curve - Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag) (A331320)

ELISA examination of immobilized recombinant human TGFB1 (2 µg/mL) binding Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag) (A331320): linear range = 1-5 ng/mL.
Publishing research using Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag) (A331320)? Please let us know so that we can list the citation on this page.

Alternative products to Recombinant Human TGF beta Receptor II Protein (C-terminal Human Fc and His Tag) (A331320)