Notice: Error: The total number of locks exceeds the lock table size
Error No: 1206
INSERT INTO oc_analytics set ip = '', agent = 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)', url = '/catalog/proteins-and-peptides/recombinant-mouse-noggin-protein-a63311', route = 'product/product', port = '4425', country_code ='US', country_name='United States', city='Columbus', organisation='', referrer='', adflag='N', adcampaign='', adurl='', product_id='63311' in D:\wwwroot_antibodies\system\library\db\mysqli.php on line 42Warning: mysqli::query(): (HY000/1206): The total number of locks exceeds the lock table size in D:\wwwroot_antibodies\system\library\db\mysqli.php on line 20Notice: Error: The total number of locks exceeds the lock table size
Error No: 1206
SELECT distinct mt2.maintarget, mt2.human_uniprot, spl.protein_codeb, spl.score, spi.protein_detail, mt2.url FROM oc_maintarget mt1, oc_string_protein_links spl, oc_string_protein_info spi, oc_maintarget mt2, oc_product_description pd WHERE mt1.maintarget = 'Noggin' AND spl.protein_codea = mt1.string_protein_code AND spi.protein_code = spl.protein_codeb AND mt2.string_protein_code = spi.protein_code and pd.maintarget = mt2.maintarget and pd.category = 'Proteins and Peptides' and pd.status = 1 and pd.uk_min_price > 0 ORDER BY spl.score DESC LIMIT 9 in D:\wwwroot_antibodies\system\library\db\mysqli.php on line 42Notice: Trying to get property 'num_rows' of non-object in D:\wwwroot_antibodies\catalog2\model\catalog\product.php on line 1860 Recombinant Mouse Noggin Protein (A63311)
ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Recombinant Mouse Noggin Protein (A63311)

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 5-8 business days.
Name
Recombinant Mouse Noggin Protein
Applications
SDS-PAGE
Expression System
Escherichia coli
Nature
Recombinant
Protein Species
Mouse
Protein Length
Protein fragment
Sequence
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC
Predicted MW
46.4 kDa
Biologically Active
Yes
Biological Activity
ED50: <2 ng/ml, as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells, corresponding to a specific activity of >5.0 × 105 IU/mg in the presence of 5 ng/ml BMP-4.
Purity
>95% as determined by SDS-PAGE.
Product Form
Lyophilized
Concentration
Reconstitution dependent.
Formulation
Lyophilized from a solution containing 30% Acetonitrile and 0.1% TFA.
Storage
Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.
Synonyms
NOG
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Recombinant Mouse Noggin Protein (A63311)? Please let us know so that we can list the citation on this page.

Alternative products to Recombinant Mouse Noggin Protein (A63311)