Anti-CD20 Antibody [ARC51683] (A306625)

Anti-CD20 Antibody [ARC51683]

Rabbit monoclonal [ARC51683] antibody to CD20.

WB, IHC, ICC/IF, Flow Cytometry

WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:500-1:1,000, Flow Cytometry: 1:50-1:200

Human

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2).

LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF

Rabbit

Monoclonal

ARC51683

IgG

Unconjugated

30 - 50 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

APY, ATOPY, B lymphocyte antigen CD20, B Lymphocyte Cell Surface Antigen B1, B-lymphocyte antigen CD20, B-lymphocyte cell-surface antigen B1, B-lymphocyte surface antigen B1, B1, Bp 35, Bp35, CD 20, CD20 antigen, CD20 receptor, CD20_HUMAN, CVID5, Fc epsilon receptor I beta chain, Fc Fragment of IgE high affinity I receptor for beta polypeptide, FCER1B, High affinity immunoglobulin epsilon receptor subunit beta, IgE Fc receptor subunit beta, IGEL, IGER, IGHER, LEU 16, LEU16, leukocyte surface antigen Leu 16, Leukocyte surface antigen Leu-16, Ly44, Membrane spanning 4 domains A1, Membrane spanning 4 domains subfamily A member 2, Membrane-spanning 4-domains subfamily A member 1, MGC3969, MS4A1, MS4A2, S7