Anti-APRIL / TNFSF13 Antibody [D05-1D4] (A280200)

Anti-APRIL / TNFSF13 Antibody [D05-1D4]

Mouse monoclonal [D05-1D4] antibody to APRIL / TNFSF13.

This antibody recognises human CD256, also known as APRIL and TNFSF13. CD256, a 17 kDa soluble protein produced from the 32 kDa type II transmembrane protein by cleavage with furin, is a member of the tumor necrosis factor ligand superfamily (TNFLSF).CD256 and its receptor (TNFRSF17/BCMA) are both important for B-cell development. It may also be implicated in the regulation of tumor cell growth and monocyte/macrophage-mediated immunological processes. CD256 is expressed in cancers of the colon, thyroid and lymphoid tissues and on monocytes and macrophages.

ELISA, WB

Human

E. coli derived recombinant protein corresponding to amino acids 105-250 of human CD256.

AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

Mouse

Monoclonal

D05-1D4

IgG2a

Protein G affinity chromatography of serum free tissue culture supernatant.

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human CD256 antibody, clone D05-1D4 recognizes human CD256, also known as APRIL and TNFSF13. CD256, a 17 kDa soluble protein produced from the 32 kDa type II transmembrane protein by cleavage with furin, is a member of the tumor necrosis factor ligand superfamily (TNFLSF).CD256 and its receptor (TNFRSF17/BCMA) are both important for B-cell development (Langat et al. 2008) . It may also be implicated in the regulation of tumor cell growth and monocyte/macrophage-mediated immunological processes. CD256 is expressed in cancers of the colon, thyroid and lymphoid tissues and on monocytes and macrophages (Haiat et al. 2006).