Anti-CD276 Antibody [MJ8] (PE) (A281220)

Anti-CD276 Antibody [MJ8] (PE)

Rat monoclonal [MJ8] antibody to CD276 (PE).

This antibody recognises mouse CD276, otherwise known as B7-H3, a ubiquitously expressed transmembrane glycoprotein and member of the B7 family of co-stimulatory molecules, which acts as both a positive and negative regulator of T-cell-mediated immune responses.CD276 is highly expressed in bone during embryogenesis, and can be induced on dendritic cells and monocytes by inflammatory cytokines. CD276 has been implicated in the development of acute and chronic transplant rejection, and is reported to have therapeutic potential as a regulator of cell-mediated immune responses to cancer, particularly in conjunction with anti-angiogenic therapy. In mice, CD276 has been linked with the development of pathogenic Th2 cells during the induction phase of allergic asthma.

Use 10µl of the suggested working dilution to label 1x10⁶ cells in 100µl. The Fc region of monoclonal antibodies may bind non-specifically to cells expressing low affinity Fc receptors. This may be reduced by using SeroBlock FcR (BUF041A or BUF041B).

Mouse

Mouse IgG2a Fc-CD276 amino acids 1-242.

MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPL

Rat

Monoclonal

MJ8

Protein G affinity chromatography of tissue culture supernatant.

Reconstitution dependent.

Lyophilized

Reconstitute with 1 ml of distilled water

Supplied in Phosphate Buffered Saline with 1% BSA, 5% Sucrose, and 0.09% Sodium Azide.

Lyophilized: Store at 4°C. Reconstituted: Store undiluted at 4°C. Do not freeze! This product is photosensitive and should be protected from light. Should this product contain a precipitate we recommend microcentrifugation before use.

Rat anti Mouse CD276 antibody, clone MJ8 recognizes mouse CD276, otherwise known as B7-H3, a ubiquitously expressed transmembrane glycoprotein and member of the B7 family of co-stimulatory molecules, which acts as both a positive and negative regulator of T-cell-mediated immune responses.CD276 is highly expressed in bone during embryogenesis, and can be induced on dendritic cells and monocytes by inflammatory cytokines. CD276 has been implicated in the development of acute and chronic transplant rejection, and is reported to have therapeutic potential as a regulator of cell-mediated immune responses to cancer, particularly in conjunction with anti-angiogenic therapy. In mice, CD276 has been linked with the development of pathogenic Th2 cells during the induction phase of allergic asthma (Nagashima et al. 2008).

4Ig-B7-H3, B7 homolog 3, B7H3, CD276 antigen, Costimulatory molecule

This product is for research use only. It is not intended for diagnostic or therapeutic use.