Anti-CD86 Antibody [ARC54011] (A306727)

Anti-CD86 Antibody [ARC54011]

Rabbit monoclonal [ARC54011] antibody to CD86.

WB, ICC/IF, Flow Cytometry

WB: 1:10,000-1:90,000, ICC/IF: 1:50-1:200, Flow Cytometry: 1:50-1:200

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 20-241 of human CD86 (NP_787058.5).

LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQP

Rabbit

Monoclonal

ARC54011

IgG

Unconjugated

60 - 85 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Activation B7-2 antigen, Activation B7-2 antigen 3, B-lymphocyte activation antigen B7-2, B-lymphocyte activation antigen B7-2 2, B7, B7 2, B7-2, B7.2, B70, B72 antigen, BU63, CD28 antigen ligand 2, CD28 antigen ligand 2 2, Cd28l2, CD28LG2, CD86 antigen, CD86 antigen (CD28 antigen ligand 2, B7-2 antigen), CD86 antigen (CD28 antigen ligand 2, B7-2 antigen) 1, 2, CD86 molecule, CD86_HUMAN, CLS1, CTLA-4 counter-receptor B7.2, CTLA-4 counter-receptor B7.2 2, 3, Early T-cell costimulatory molecule 1, ETC-1, FUN 1, FUN-1, LAB72, Ly-58, Ly58, MB7, MB7-2, Membrane glycoprotein, MGC34413, T-lymphocyte activation antigen CD86, TS/A-2