Anti-CFTR Antibody [M3A7] (A281002)

Anti-CFTR Antibody [M3A7]

Mouse monoclonal [M3A7] antibody to CFTR.

This antibody recognises the human cystic fibrosis transmembrane conductance regulator (CFTR). It recognises an epitope localizing to the ABC transporter 2 domain, specifically to a region between amino acids 1370 to 1380.

IHC-Fr, WB, IP

WB 2: 10 µg/ml

Human

This antibody does not cross react with Mouse

Fusion protein containing residues 1197-1480 of human CFTR.

HVKKDDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL

Mouse

Monoclonal

M3A7

IgG1

Unconjugated

170kDA

Liquid

Supplied in Phosphate Buffered Saline with 0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human Cystic Fibrosis Transmembrane Conductance Regulator antibody, clone M3A7 recognizes the human cystic fibrosis transmembrane conductance regulator (CFTR). It recognises an epitope localizing to the ABC transporter 2 domain, specifically to a region between amino acids 1370 to 1380.

ABC 35, ABC35, ABCC 7, ABCC7, ATP binding cassette sub family C member 7, ATP Binding Cassette Superfamily C Member 7, ATP binding cassette transporter sub family C member 7, ATP-binding cassette sub-family C member 7, cAMP dependent chloride channel, cAMP-dependent chloride channel, CF, CFTR/MRP, CFTR_HUMAN, Channel conductance controlling ATPase, Channel conductance-controlling ATPase, Cystic fibrosis transmembrane conductance regulator, Cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub family C, member 7), Cystic fibrosis transmembrane conductance regulator ATP binding cassette sub family C member 7, Cystic Fibrosis Transmembrane Regulator, dJ760C5.1, MRP 7, MRP7, TNR CFTR