Anti-CHREBP Antibody (A15813)

Anti-CHREBP Antibody

Rabbit polyclonal antibody to CHREBP.

WB: 1:500-1:1,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 17-175 of human MLXIPL (NP_116569.1).

VAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSDSLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIE

Rabbit

Polyclonal

IgG

Unconjugated

72 kDa / 110 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

bHLHd14, carbohydrate response element binding protein, Carbohydrate responsive element binding protein, Class D basic helix-loop-helix protein 14, MIO, MLX interacting protein like, Mlx interactor, MLX-interacting protein-like, MLXIPL, MONDOB, WBS14_HUMAN, WBSCR 14, WBSCR14, Williams Beuren syndrome chromosome region 14, Williams Beuren syndrome chromosome region 14 protein, Williams-Beuren syndrome chromosomal region 14 protein, WS basic helix loop helix leucine zipper protein, WS basic-helix-loop-helix leucine zipper protein, WS bHLH, WS-bHLH