+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-Claudin 6 Antibody (A308664)

Western Blot - Anti-Claudin 6 Antibody (A308664) - Antibodies.com Western Blot - Anti-Claudin 6 Antibody (A308664) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to Claudin 6 for WB.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-Claudin 6 Antibody
Description
Rabbit polyclonal antibody to Claudin 6.
Applications
WB
Dilutions
WB: 1:500-1:1,000
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 121-220 of human Claudin 6 (NP_067018.2).
Sequence
SGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
23 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
Claudin-6, Claudin6, CLD6_HUMAN, CLDN 6, CLDN6, OTTHUMP00000159248, Skullin, Skullin 2, UNQ757/PRO1488
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-Claudin 6 Antibody (A308664) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-Claudin 6 Antibody (A308664)
Western blot analysis of extracts of OVCAR3 cells, using Anti-Claudin 6 Antibody (A308664) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Western Blot - Anti-Claudin 6 Antibody (A308664) - Antibodies.comEnlarge Image
Figure 2: Western Blot - Anti-Claudin 6 Antibody (A308664)
Western blot analysis of extracts of Rat brain, using Anti-Claudin 6 Antibody (A308664) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 180s.
Publishing research using Anti-Claudin 6 Antibody (A308664)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Claudin 6 Antibody (A308664)

SDS-PAGE - Anti-Claudin 6 Antibody [IMAB027] - Low endotoxin, Azide free (A323968) - Antibodies.com
(7)
A323968
Anti-Claudin 6 Antibody [IMAB027] - Low endotoxin, Azide free
Recombinant chimeric monoclonal [IMAB027] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [DS-9606a] - Low endotoxin, Azide free (A323967) - Antibodies.com
(6)
A323967
Anti-Claudin 6 Antibody [DS-9606a] - Low endotoxin, Azide free
Recombinant human monoclonal [DS-9606a] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [AB3-7] - Low endotoxin, Azide free (A323970) - Antibodies.com
(3)
A323970
Anti-Claudin 6 Antibody [AB3-7] - Low endotoxin, Azide free
Recombinant human monoclonal [AB3-7] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [AB1-11] - Low endotoxin, Azide free (A323969) - Antibodies.com
(2)
A323969
Anti-Claudin 6 Antibody [AB1-11] - Low endotoxin, Azide free
Recombinant human monoclonal [AB1-11] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [64A] - Low endotoxin, Azide free (A323971) - Antibodies.com
(2)
A323971
Anti-Claudin 6 Antibody [64A] - Low endotoxin, Azide free
Recombinant human monoclonal [64A] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [AE3-20] - Low endotoxin, Azide free (A323972) - Antibodies.com
(2)
A323972
Anti-Claudin 6 Antibody [AE3-20] - Low endotoxin, Azide free
Recombinant human monoclonal [AE3-20] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [IM-301] - Low endotoxin, Azide free (A323973) - Antibodies.com
(2)
A323973
Anti-Claudin 6 Antibody [IM-301] - Low endotoxin, Azide free
Recombinant human monoclonal [IM-301] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [IM-302] - Low endotoxin, Azide free (A323974) - Antibodies.com
(2)
A323974
Anti-Claudin 6 Antibody [IM-302] - Low endotoxin, Azide free
Recombinant human monoclonal [IM-302] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
Flow Cytometry - IMAB027 Biosimilar - Anti-Claudin 6 Antibody - BSA and Azide free (A318880) - Antibodies.com
(3)
A318880
IMAB027 Biosimilar - Anti-Claudin 6 Antibody - BSA and Azide free
Recombinant humanized monoclonal antibody to Claudin 6 for ELISA and Flow Cytometry.
Western blot - CLDN6 Antibody from Signalway Antibody (34597) - Antibodies.com
(3)
A35033
Anti-CLDN6 Antibody
Rabbit polyclonal antibody to CLDN6 for WB, IHC and IF.
CLDN6 Antibody from Signalway Antibody (43653) - Antibodies.com
(2)
A46557
Anti-CLDN6 Antibody
Rabbit polyclonal antibody to CLDN6 for IHC.
Western blot - Claudin 6 (Phospho-Tyr219) Antibody from Signalway Antibody (11793) - Antibodies.com
A50765
Anti-Claudin 6 (Phospho-Tyr219) Antibody
Rabbit polyclonal antibody to Claudin 6 (Phospho-Tyr219) for WB.
SDS-PAGE - Anti-Claudin 6 Antibody [IMAB027] - Low endotoxin, Azide free (A323968) - Antibodies.com
(7)
A323968
Anti-Claudin 6 Antibody [IMAB027] - Low endotoxin, Azide free
Recombinant chimeric monoclonal [IMAB027] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [DS-9606a] - Low endotoxin, Azide free (A323967) - Antibodies.com
(6)
A323967
Anti-Claudin 6 Antibody [DS-9606a] - Low endotoxin, Azide free
Recombinant human monoclonal [DS-9606a] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [AB3-7] - Low endotoxin, Azide free (A323970) - Antibodies.com
(3)
A323970
Anti-Claudin 6 Antibody [AB3-7] - Low endotoxin, Azide free
Recombinant human monoclonal [AB3-7] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [AB1-11] - Low endotoxin, Azide free (A323969) - Antibodies.com
(2)
A323969
Anti-Claudin 6 Antibody [AB1-11] - Low endotoxin, Azide free
Recombinant human monoclonal [AB1-11] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [64A] - Low endotoxin, Azide free (A323971) - Antibodies.com
(2)
A323971
Anti-Claudin 6 Antibody [64A] - Low endotoxin, Azide free
Recombinant human monoclonal [64A] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [AE3-20] - Low endotoxin, Azide free (A323972) - Antibodies.com
(2)
A323972
Anti-Claudin 6 Antibody [AE3-20] - Low endotoxin, Azide free
Recombinant human monoclonal [AE3-20] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [IM-301] - Low endotoxin, Azide free (A323973) - Antibodies.com
(2)
A323973
Anti-Claudin 6 Antibody [IM-301] - Low endotoxin, Azide free
Recombinant human monoclonal [IM-301] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-Claudin 6 Antibody [IM-302] - Low endotoxin, Azide free (A323974) - Antibodies.com
(2)
A323974
Anti-Claudin 6 Antibody [IM-302] - Low endotoxin, Azide free
Recombinant human monoclonal [IM-302] antibody to Claudin 6 for ELISA, FACS, Functional Assay and In Vivo.
Flow Cytometry - IMAB027 Biosimilar - Anti-Claudin 6 Antibody - BSA and Azide free (A318880) - Antibodies.com
(3)
A318880
IMAB027 Biosimilar - Anti-Claudin 6 Antibody - BSA and Azide free
Recombinant humanized monoclonal antibody to Claudin 6 for ELISA and Flow Cytometry.
Western blot - CLDN6 Antibody from Signalway Antibody (34597) - Antibodies.com
(3)
A35033
Anti-CLDN6 Antibody
Rabbit polyclonal antibody to CLDN6 for WB, IHC and IF.
CLDN6 Antibody from Signalway Antibody (43653) - Antibodies.com
(2)
A46557
Anti-CLDN6 Antibody
Rabbit polyclonal antibody to CLDN6 for IHC.
Western blot - Claudin 6 (Phospho-Tyr219) Antibody from Signalway Antibody (11793) - Antibodies.com
A50765
Anti-Claudin 6 (Phospho-Tyr219) Antibody
Rabbit polyclonal antibody to Claudin 6 (Phospho-Tyr219) for WB.
See all Anti-Claudin 6 Antibodies
Main Menu Contact Us 0Checkout
Top