ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Recombinant Gilthead Seabream Growth Hormone Protein (A63103)

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 5-8 business days.
Name
Recombinant Gilthead Seabream Growth Hormone Protein
Applications
Binding Assay
Expression System
Escherichia coli
Nature
Recombinant
Protein Species
Gilthead Seabream
Protein Length
Protein fragment
Sequence
AQPITDGQRLFSIAVSRVQHLHLLAQRLFSDFESSLQTEEQPQLNKIFLQDFCNCDYIISPIDKHETQRSSVLKLLSISYRLVESWEFPSRSLSGGSAPRNQISPKLSELKTGIHLLIRANEDGAEIFPDRSALQLAPYGNYYQSLGTDESLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL
Predicted MW
21.4 kDa
Biologically Active
Yes
Biological Activity
Binding assays of the 125I-labeled gilthead seabream GH to dolphin fish liver microsomal fraction resulted in high specific binding characterized by a Ka of 1.93 nM and a Bmax of 540 fmol/mg microsomal fraction protein. Recombinant gilthead seabream Growth Hormone, like ovine placental lactogen, exhibited growth-stimulating activity when applied orally to Sparus aurata larvae or intraperitoneally to juvenile fish.
Purity
>98% as determined by SEC-HPLC and SDS-PAGE.
Product Form
Lyophilized
Concentration
1 mg/ml
Formulation
Lyophilized from a solution containing 0.02% Sodium Bicarbonate.
Storage
Shipped at ambient temperature. Lyophilized: Short term (2 weeks) store at 25°C. Long term store below -18°C. Reconstituted and filter sterilization: Short term (4 weeks) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.
Synonyms
GH, GH-N, GH1, Growth hormone 1, Pituitary growth hormone, Somatotropin
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Recombinant Gilthead Seabream Growth Hormone Protein (A63103)? Please let us know so that we can list the citation on this page.

Alternative products to Recombinant Gilthead Seabream Growth Hormone Protein (A63103)

Proteins predicted to interact with Growth Hormone

Predicted protein interactions based upon String database. Revelancy score correlates with probability of interaction.
99.3% Relevancy Score
99% Relevancy Score
96.4% Relevancy Score
95.9% Relevancy Score
95.6% Relevancy Score
94.9% Relevancy Score
94.4% Relevancy Score
93.6% Relevancy Score