ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

IL 8 Rabbit (A61298)

This product is discontinued

IL 8 Rabbit (A61298) has been discontinued and is no longer available.

View all available products.

Name
IL 8 Rabbit
Description
Interleukin-8 Rabbit Recombinant (CXCL8)
Source
Escherichia Coli.
Sequence
AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV QIFLKRAEQQES.
Purity
Greater than 90% as determined by SDS-PAGE.
Formulation
The IL-8 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
Storage
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Synonyms
(Ala-IL-8)77, (Ser-IL-8)72, 3-10C, 9E3, AMCF-I, B-ENAP, Beta thromboglobulin like protein, Beta-thromboglobulin-like protein, C X C motif chemokine 8, C-X-C motif chemokine 8, CEF-4, Chemokine (C X C motif) ligand 8, chemokine, CXC motif, ligand 8, CXCL8 , Emoctakin, GCP 1, GCP-1, GCP/IL-8 protein I, GCP/IL-8 protein II, GCP/IL-8 protein III, GCP/IL-8 protein IV, GCP/IL-8 protein V, GCP/IL-8 protein VI, GCP1 , Granulocyte chemotactic protein 1, IL 8, IL-8, IL-8(1-77), IL-8(9-77), IL8, IL8/NAP1 form I, IL8/NAP1 form II, IL8/NAP1 form III, IL8/NAP1 form IV, IL8/NAP1 form V, IL8/NAP1 form VI, IL8_HUMAN, Inteleukin 8, Interleukin 8, K60, LECT , LUCT , Lymphocyte derived neutrophil activating factor, Lymphocyte-derived neutrophil-activating factor, LYNAP, MDNCF, MDNCF-b, MDNCF-c, MONAP, Monocyte derived neutrophil activating peptide, Monocyte derived neutrophil chemotactic factor, Monocyte-derived neutrophil chemotactic factor, Monocyte-derived neutrophil-activating peptide, NAF, NAP 1, NAP-1, NAP1 , Neutrophil activating peptide 1, Neutrophil activating protein 1, Neutrophil-activating factor, Neutrophil-activating protein 1, Protein 3 10C, Protein 3-10C, SCYB8, Small inducible cytokine subfamily B member 8, T cell chemotactic factor, T-cell chemotactic factor, TSG-1, TSG1
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.