Anti-CTLA4 Antibody (A89497)

Anti-CTLA4 Antibody

Rabbit polyclonal antibody to CTLA4.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 49-223 of human CTLA4 (NP_005205.2).

SSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN

Rabbit

Polyclonal

IgG

Unconjugated

36 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ALPS5, CD, CD 152, CD152, CD152 antigen, CD152 isoform, Celiac disease 3, CELIAC3, CTLA 4, CTLA-4, CTLA4_HUMAN, Cytotoxic T cell associated 4, Cytotoxic T lymphocyte antigen 4, Cytotoxic T lymphocyte associated 4, Cytotoxic T lymphocyte associated 4, soluble isoform, included, Cytotoxic T lymphocyte associated antigen 4, Cytotoxic T lymphocyte associated antigen 4 short spliced form, Cytotoxic T lymphocyte associated protein 4, Cytotoxic T lymphocyte associated serine esterase 4, Cytotoxic T lymphocyte protein 4, Cytotoxic T-lymphocyte protein 4, Cytotoxic T-lymphocyte-associated antigen 4, GRD4, GSE, ICOS, IDDM12, insulin-dependent diabetes mellitus 12, Ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4, OTTHUMP00000216623