Anti-CYP24A1 Antibody (A13669)

Anti-CYP24A1 Antibody

Rabbit polyclonal antibody to CYP24A1.

WB, IHC

WB: 1:500-1:1,000, IHC: 1:50-1:100

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 36-448 of human CYP24A1 (NP_001122387.1).

PQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR

Rabbit

Polyclonal

IgG

Unconjugated

65 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

1, 1 25 @dihydroxyvitamin D3 24 hydroxylase, 1 25 dihydroxyvitamin D(3) 24 hydroxylase, 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial, 24 OHase, 24-OHase, 25-dihydroxyvitamin D(3) 24-hydroxylase, CP 24, CP24, CP24A_HUMAN, CYP 24, CYP24, Cytochrome P450 24A1, Cytochrome P450 24A1 mitochondrial, cytochrome P450 CC24, Cytochrome P450 family 24, Cytochrome P450 family 24 subfamily A member 1, Cytochrome P450 family 24 subfamily A polypeptide 1, Cytochrome P450 subfamily XXIV, Cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase), Cytochrome P450-CC24, EC 1.14.13.n4, Exo mitochondrial protein, HCAI, HCINF1, MGC126273, MGC126274, mitochondrial, P450 CC24, Vitamin D 24 hydroxylase, Vitamin D(3) 24 hydroxylase, Vitamin D(3) 24-hydroxylase