Anti-DR5 Antibody (A8894)

Anti-DR5 Antibody

Rabbit polyclonal antibody to DR5.

WB: 1:500-1:2,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 260-440 of human DR5/TRAILR2/TNFRSF10B (NP_003833.4).

RSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIEDHLLSSGKFMYLEGNADSAMS

Rabbit

Polyclonal

IgG

Unconjugated

48 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Apoptosis inducing protein TRICK2A/2B, Apoptosis inducing receptor TRAIL R2, CD262, CD262 antigen, Cytotoxic TRAIL receptor 2, Death domain containing receptor for TRAIL/Apo 2L, Death receptor 5, Fas like protein, KILLER, KILLER/DR5, OTTHUMP00000123492, OTTHUMP00000123493, p53 regulated DNA damage inducible cell death receptor(killer), TNF related apoptosis inducing ligand receptor 2, TNF-related apoptosis-inducing ligand receptor 2, TNFRSF10B, TR10B_HUMAN, TRAIL R2, TRAIL receptor 2, TRAIL-R2, TRAILR2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor necrosis factor receptor like protein ZTNFR9, Tumor necrosis factor receptor superfamily member 10B, Tumor necrosis factor receptor superfamily, member 10b, ZTNFR9