Anti-DYRK1A Antibody (A12660)

Anti-DYRK1A Antibody

Rabbit polyclonal antibody to DYRK1A.

WB: 1:500-1:1,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 624-763 of human DYRK1A (NP_001387.2).

LGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Dual specificity tyrosine (Y) phosphorylation regulated kinase 1A, Dual specificity tyrosine phosphorylation regulated kinase, Dual specificity tyrosine phosphorylation regulated kinase 1, Dual specificity tyrosine phosphorylation regulated kinase 1A, Dual specificity tyrosine-phosphorylation-regulated kinase 1A, Dual specificity YAK 1 related kinase, Dual specificity YAK1 related kinase, Dual specificity YAK1-related kinase, DYR1A_HUMAN, DYRK, DYRK 1, DYRK 1A, DYRK1, DYRKA, hMNB, HP 86, HP86, Minibrain (Drosophila) homolog, Minibrain homolog, Minibrain, Drosophila, homolog of, MNB, MNB protein kinase, Mnb protein kinase homolog hp86, MNB protein kinase, Serine/threonine-specific, MNB/DYRK protein kinase, MNBH, MRD7, OTTHUMP00000109090, OTTHUMP00000109091, OTTHUMP00000109094, OTTHUMP00000174799, Protein kinase minibrain homolog, Serine/threonine kinase MNB