Anti-EGFR Antibody [ARC1139] (A305672)

Anti-EGFR Antibody [ARC1139]

Rabbit monoclonal [ARC1139] antibody to EGFR.

WB, IHC

WB: 1:500-1:2,000, IHC: 1:50-1:200

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 800-900 of human EGFR (L858R) (P00533).

DYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY

Rabbit

Monoclonal

ARC1139

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

9030024J15Rik, AI552599, Avian erythroblastic leukemia viral (v erb b) oncogene homolog , Avian erythroblastic leukemia viral (verbb) oncogene homolog , Cell growth inhibiting protein 40 , Cell proliferation inducing protein 61 , EGF R, EGFR_HUMAN, Epidermal growth factor receptor, Epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , Epidermal growth factor receptor (erythroblastic leukemia viral (v erb b) oncogene homolog avian) , erb-b2 receptor tyrosine kinase 1, Erbb, erbb 1, Erbb1, Errp, Erythroblastic leukemia viral (v erb-b) oncogene homolog, HER1, mENA , NISBD2, Oncogen ERBB, Oncogene ERBB , OTTMUSP00000005385, OTTMUSP00000005386, PIG61, Proto oncogene c ErbB 1, Proto-oncogene c-ErbB-1, Receptor tyrosine protein kinase ErbB 1 , Receptor tyrosine protein kinase ErbB1 , Receptor tyrosine-protein kinase ErbB-1, RP23-295E4.1, SA7, Species antigen 7, Urogastrone, v-erb-b Avian erythroblastic leukemia viral oncogen homolog, wa2, Wa5