Anti-EGLN2 Antibody (A91569)

Anti-EGLN2 Antibody

Rabbit polyclonal antibody to EGLN2.

WB: 1:500-1:2000

Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 150-250 of human EGLN2 (NP_444274.1).

MSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGC

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Egl nine homolog 2, EIT-6, EIT6, Estrogen-induced tag 6, HIF-PH1, HIF-prolyl hydroxylase 1, HPH-1, HPH-3, Hypoxia-inducible factor prolyl hydroxylase 1, Prolyl hydroxylase domain-containing protein 1, Prolyl hydroxylase EGLN2