Anti-ELMO2 Antibody (A91322)

Anti-ELMO2 Antibody

Rabbit polyclonal antibody to ELMO2.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 42-120 of human ELMO2 (NP_877496.1).

SLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSADVTFATEF

Rabbit

Polyclonal

IgG

Unconjugated

83 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CED 12, Ced 12 homolog 2, CED 12 homolog A, CED 12A, CED-12, ced-12 homolog 2, CED12, CED12 homolog A, CED12, C. elegans, homolog of, 2, CED12A, ELMO 2, ELMO-2, ELMO2_HUMAN, Engulfment and cell motility 2, Engulfment and cell motility 2 (ced 12 homolog, C. elegans), Engulfment and cell motility gene 2, Engulfment and cell motility protein 2, FLJ11656, hCED 12A, hCED-12A, hCED12A, KIAA1834, OTTHUMP00000031762, PH domain protein CED12A, Protein ced 12 homolog A, Protein ced-12 homolog A