Anti-EpCAM Antibody [ARC0277] (A309201)

Anti-EpCAM Antibody [ARC0277]

Rabbit monoclonal [ARC0277] antibody to EpCAM.

WB, IHC, ICC/IF

WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 215-314 of human EpCAM (P16422).

YFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA

Rabbit

Monoclonal

ARC0277

IgG

Unconjugated

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

17 1A, 323/A3, Adenocarcinoma associated antigen, Adenocarcinoma-associated antigen, Antigen identified by monoclonal, AUA1, CD326, CD326 antigen, Cell surface glycoprotein Trop 1, Cell surface glycoprotein Trop 2, Cell surface glycoprotein Trop-1, CO 17A, CO17 1A, CO17A, DIAR5, EGP, EGP 2, EGP2, EGP314, EGP40, Ep CAM, Ep-CAM, EpCAM1, EPCAM_HUMAN, Epithelial cell adhesion molecule, Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD), Epithelial cell surface antigen, Epithelial cellular adhesion molecule, Epithelial glycoprotein, Epithelial glycoprotein 1, Epithelial glycoprotein 314, ESA, GA733 1, GA733 2, GA733-2, gastrointestinal tumor-associated antigen 2, 35-KD glycoprotein, gp4, hEGP 2, hEGP314, HNPCC8, Human epithelial glycoprotein 2, KS 1/4 antigen, KS1/4, KSA, Ly74, Lymphocyte antigen 74, M1S 1, M1S2, M4S1, Major gastrointestinal tumor associated protein GA733 2, Major gastrointestinal tumor-associated protein GA733-2, mEGP314, Membrane component chromosome 4 surface marker (35kD glycoprotein), Membrane component, chromosome 4, surface marker, Membrane component, chromosome 4, surface marker 1, MIC18, MK 1, Protein 289A, TACD1, TACSTD1, TROP1, Tumor associated calcium signal transducer 1, Tumor associated calcium signal transducer 2 precursor, Tumor-associated calcium signal transducer 1