Anti-EPHA1 Antibody (A10116)

Anti-EPHA1 Antibody

Rabbit polyclonal antibody to EPHA1.

WB: 1:500-1:2000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human EPHA1 (NP_005223.4).

MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNGTPLYMYQDCPMQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKETFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLVSGSVKLNVERCSLGRLTRRGLYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLVEVAGT

Rabbit

Polyclonal

IgG

Affinity purification.

100kDa

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

EPH, Eph receptor A1, EPH tyrosine kinase, EPH tyrosine kinase 1, EPHA1_HUMAN, Ephrin receptor Eph A1, Ephrin type A receptor 1, Ephrin type-A receptor 1, EPHT, EPHT 1, EPHT1, Erythropoietin producing hepatoma amplified sequence, Erythropoietin-producing hepatoma receptor, Esk, hEpha1, MGC163163, Oncogene EPH, Soluble EPHA1 variant 1, Soluble EPHA1 variant 2, Tyrosine protein kinase receptor EPH, Tyrosine-protein kinase receptor EPH