Anti-FKBP12 Antibody [ARC0654] (A80626)

Anti-FKBP12 Antibody [ARC0654]

Rabbit monoclonal [ARC0654] antibody to FKBP12.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 29-108 of human FKBP12 (P62942).

GMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Rabbit

Monoclonal

ARC0654

IgG

Unconjugated

14 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

12 kDa FK506-binding protein, 12 kDa FKBP, Calstabin 1, FK506 binding protein 1, FK506 binding protein 12, FK506 binding protein 1A, FK506 binding protein 1A (12kD), FK506 binding protein 1A 12kDa, FK506 binding protein T cell 12 kD, FK506 binding protein, T cell, 12 kD, FK506 binding protein12, FK506-binding protein 1A, FKB1A_HUMAN, FKBP 12, FKBP 1A, FKBP-12, FKBP-1A, FKBP1, FKBP12 Exip3, FKBP12C, fkbp1a, Immunophilin FKBP12, Peptidyl prolyl cis trans isomerase, Peptidyl-prolyl cis-trans isomerase FKBP1A, PKC12, PKCI2, PPIase, PPIase FKBP1A, Protein kinase C inhibitor 2, Rotamase