Anti-FKBP51 Antibody (A9309)

Anti-FKBP51 Antibody

Rabbit polyclonal antibody to FKBP51.

WB: 1:200-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 308-457 of human FKBP51/FKBP51/FKBP51/FKBP5 (NP_001139247.1).

ESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV

Rabbit

Polyclonal

IgG

Unconjugated

51 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

51 kDa FK506 binding protein, 51 kDa FK506 binding protein 5, 51 kDa FK506-binding protein, 51 kDa FKBP, 54 kDa progesterone receptor associated immunophilin, 54 kDa progesterone receptor-associated immunophilin, AIG 6, AIG6, Androgen regulated protein 6, Androgen-regulated protein 6, FF1 antigen, FK506 binding protein 5, FK506-binding protein 5, FKBP 5, FKBP 51, FKBP 54, FKBP-5, FKBP-51, FKBP5, FKBP54, FKBP5_HUMAN, HSP90 binding immunophilin, HSP90-binding immunophilin, MGC111006, OTTHUMP00000016268, P54, Peptidyl prolyl cis trans isomerase, Peptidyl-prolyl cis-trans isomerase FKBP5, Peptidylprolyl cis trans isomerase, PPIase, PPIase FKBP5, Ptg 10, Ptg10, Rotamase, T cell FK506 binding protein