Anti-HAND2 Antibody (A15506)

Anti-HAND2 Antibody

Rabbit polyclonal antibody to HAND2.

WB, ICC/IF

WB: 1:500-1:2,000, ICC/IF: 1:50-1:100

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 150-220 of human HAND2 (NP_068808.1).

YLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ

Rabbit

Polyclonal

IgG

Unconjugated

26 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AI225906, AI661148, autonomic nervous system and neural crest derivatives-expressed protein 2, Basic helix loop helix transcription factor HAND2, bHLHa26, Class A basic helix-loop-helix protein 26, Deciduum, Deciduum heart autonomic nervous system and neural crest derivatives expressed protein 2, dHAND, DHAND 2, DHAND2, Ehand 2, Ehand2, FLJ16260, HAND 2, HAND2_HUMAN, heart, Heart and neural crest derivatives expressed 2, Heart and neural crest derivatives expressed protein 2, heart and neural crest derivatives expressed transcript 2, Heart- and neural crest derivatives-expressed protein 2, Hed, Highly similar to dHAND M musculus, MGC125303, MGC125304, Th 2, Th2, Thing 2, Thing2