Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)

Name: Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951]
Brand: Antibodies.com
SKU: A306104

Enlarge Image

This product is discontinued

Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104) has been discontinued and is no longer available.

View all Anti-Heterogeneous nuclear ribonucleoprotein M Antibodies.

Specifications

Name

Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951]

Description

Rabbit monoclonal [ARC2951] antibody to Heterogeneous nuclear ribonucleoprotein M.

Applications

WB, IHC, ICC/IF, IP

Dilutions

WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:50-1:200

Reactivity

Human, Mouse, Rat

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human HNRNPM (P52272).

Sequence

GRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGDFFPPERPQQLPHG

Host

Rabbit

Clonality

Monoclonal

Clone ID

ARC2951

Isotype

IgG

Conjugate

Unconjugated

Purification

Affinity purification.

Molecular Weight

75 kDa

Product Form

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Storage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonyms

CEA receptor, CEAR, hnRNP M, HNRNPM, HNRNPM4, HNRPM, HNRPM4, HNRPM_HUMAN, HTGR1, N-acetylglucosamine receptor 1, NAGR1

Isotype Controls

Suitable Secondaries

See all Anti-Rabbit IgG Secondaries →

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Scientific Validation Data (11)

Enlarge Image

Figure 1: Western Blot - Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)

Western blot analysis of extracts of various cell lines, using Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 3s.

Enlarge Image

Figure 2: Western Blot - Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)

Enlarge Image

Figure 3: Western Blot - Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)

Western blot analysis of extracts of Rat brain, using Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 180s.

Enlarge Image

Figure 4: Immunohistochemistry - Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 5: Immunohistochemistry - Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)

Immunohistochemistry analysis of paraffin-embedded human liver using Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 6: Immunohistochemistry - Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)

Immunohistochemistry analysis of paraffin-embedded mouse brain using Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 7: Immunohistochemistry - Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)

Immunohistochemistry analysis of paraffin-embedded rat heart using Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 8: Immunohistochemistry - Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)

Immunohistochemistry analysis of paraffin-embedded rat kidney using Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 9: Immunofluorescence - Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)

Immunofluorescence analysis of MCF7 cells using Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Enlarge Image

Figure 10: Immunofluorescence - Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)

Immunofluorescence analysis of NIH/3T3 cells using Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Enlarge Image

Figure 11: Immunofluorescence - Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)

Immunofluorescence analysis of PC-12 cells using Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Show more images

Publishing research using Anti-Heterogeneous nuclear ribonucleoprotein M Antibody [ARC2951] (A306104)? Please let us know so that we can list the citation on this page.