Anti-Human IgG Antibody [ARC53385] (A308177)

Name: Anti-Human IgG Antibody [ARC53385]
Brand: Antibodies.com
SKU: A308177
Price: 470.0 USD
Availability: InStock

Enlarge Image

$470

Rabbit monoclonal [ARC53385] antibody to Human IgG for WB, IHC, ICC/IF and Flow Cytometry.

100% Guarantee

Price Match Guarantee

Delivery

Freight Charges

$40 to United States

Lead Time

5-8 Business Days

Contact Us

Telephone

+1 (314) 370-6046

orders@antibodies.com

Guarantees

100% Quality Guarantee

Price Match Guarantee

Specifications

Name

Anti-Human IgG Antibody [ARC53385]

Description

Rabbit monoclonal [ARC53385] antibody to Human IgG.

Applications

WB, IHC, ICC/IF, Flow Cytometry

Dilutions

WB: 1:2,000-1:4,000, IHC: 1:500-1:1,000, Flow Cytometry: 1:50-1:200, ICC/IF: 1:50-1:200

Reactivity

Human

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 100-330 of human Human IgG1 (Fc) (P01857).

Sequence

PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Host

Rabbit

Clonality

Monoclonal

Clone ID

ARC53385

Isotype

IgG

Conjugate

Unconjugated

Purification

Affinity purification.

Product Form

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Storage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonyms

FLJ39988, FLJ40036, FLJ40253, FLJ40587, FLJ40789, FLJ40834, G1m marker, G2m marker, G3m marker, G4m marker, HDC, Heavy chain disease protein, Human immunglobulin G, Ig gamma 1 chain C region, Ig gamma 2 chain C region, Ig gamma 3 chain C region, Ig gamma 4 chain C region, IgG heavy chain locus, IGHG 1, IGHG 2, IGHG 3, IGHG 4, IGHG1, IGHG2, IGHG3, IGHG4, Immunoglobulin Gm1, Immunoglobulin Gm3, Immunoglobulin Gm4, Immunoglobulin heavy constant gamma 1, immunoglobulin heavy constant gamma 1 (G1m marker), Immunoglobulin heavy constant gamma 2, immunoglobulin heavy constant gamma 2 (G2m marker), Immunoglobulin heavy constant gamma 3, immunoglobulin heavy constant gamma 3 (G3m marker), Immunoglobulin heavy constant gamma 4, immunoglobulin heavy constant gamma 4 (G4m marker), MGC117419, MGC45809

Isotype Controls

Suitable Secondaries

See all Anti-Rabbit IgG Secondaries →

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Scientific Validation Data (10)

Enlarge Image

Figure 1: Western Blot - Anti-Human IgG Antibody [ARC53385] (A308177)

Western blot analysis of extracts of 293T cells, using Anti-Human IgG Antibody [ARC53385] (A308177) at 1:4,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.

Enlarge Image

Figure 2: Immunohistochemistry - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-Human IgG Antibody [ARC53385] (A308177) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 3: Immunohistochemistry - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunohistochemistry analysis of paraffin-embedded human brain (negative control sample) using Anti-Human IgG Antibody [ARC53385] (A308177) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 4: Immunohistochemistry - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-Human IgG Antibody [ARC53385] (A308177) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 5: Immunofluorescence - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunofluorescence analysis of 293F-IgG(FC) and 293F cells using Anti-human IgG Antibody [ARC53385] (A308177) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Enlarge Image

Figure 6: Immunofluorescence - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunofluorescence analysis of Daudi using Anti-human IgG Antibody [ARC53385] (A308177) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Enlarge Image

Figure 7: Immunofluorescence - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunofluorescence analysis of human tonsil using Anti-human IgG Antibody [ARC53385] (A308177) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Enlarge Image

Figure 8: Flow Cytometry - Anti-Human IgG Antibody [ARC53385] (A308177)

Flow cytometry analysis of Daudi cells, stained with Rabbit IgG isotype control (10 µg/ml, blue line) or Anti-Human IgG Antibody [ARC53385] (A308177), (10 µg/ml orange line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained Daudi cells, used as blank control (red line).

Enlarge Image

Figure 9: Flow Cytometry - Anti-Human IgG Antibody [ARC53385] (A308177)

Flow cytometry analysis of 293F(Transfection) cells, stained with Rabbit IgG isotype control (10 µg/ml, blue line) or Anti-Human IgG Antibody [ARC53385] (A308177), (10 µg/ml orange line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained 293F(Transfection) cells, used as blank control (red line).

Enlarge Image

Figure 10: Flow Cytometry - Anti-Human IgG Antibody [ARC53385] (A308177)

Flow cytometry analysis of 293F cells, stained with Rabbit IgG isotype control (10 µg/ml, blue line) or Anti-Human IgG Antibody [ARC53385] (A308177), (10 µg/ml orange line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained 293F cells, used as blank control (red line).

Show more images

Publishing research using Anti-Human IgG Antibody [ARC53385] (A308177)? Please let us know so that we can list the citation on this page.