Anti-IKZF3 Antibody [ARC2781] (A306354)

Name: Anti-IKZF3 Antibody [ARC2781]
Brand: Antibodies.com
SKU: A306354
Price: 470.0 USD
Availability: InStock

Enlarge Image

$470

Rabbit monoclonal [ARC2781] antibody to IKZF3 for WB, IHC, ICC/IF and IP.

100% Guarantee

Price Match Guarantee

Delivery

Freight Charges

$40 to United States

Lead Time

5-8 Business Days

Contact Us

Telephone

+1 (314) 370-6046

orders@antibodies.com

Guarantees

100% Quality Guarantee

Price Match Guarantee

Specifications

Name

Anti-IKZF3 Antibody [ARC2781]

Description

Rabbit monoclonal [ARC2781] antibody to IKZF3.

Applications

WB, IHC, ICC/IF, IP

Dilutions

WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:100-1:500

Reactivity

Human, Mouse, Rat

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 400-509 of human IKZF3 (Q9UKT9).

Sequence

IYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIARGEHRALLK

Host

Rabbit

Clonality

Monoclonal

Clone ID

ARC2781

Isotype

IgG

Conjugate

Unconjugated

Purification

Affinity purification.

Molecular Weight

65 kDa

Product Form

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Storage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonyms

AIO, Aiolos, IKAROS family zinc finger 3, IKAROS family zinc finger 3 (Aiolos), Ikaros family zinc finger protein 3, IKZF 3, IKZF3_HUMAN, zinc finger DNA binding protein Aiolos, Zinc finger protein Aiolos, Zinc finger protein subfamily 1A 3, Zinc finger protein subfamily 1A 3 (Aiolos), Zinc finger protein subfamily 1A, member 3, ZNFN1A3

Isotype Controls

Suitable Secondaries

See all Anti-Rabbit IgG Secondaries →

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Scientific Validation Data (10)

Enlarge Image

Figure 1: Western Blot - Anti-IKZF3 Antibody [ARC2781] (A306354)

Western blot analysis of extracts of Raji cells, using Anti-IKZF3 Antibody [ARC2781] (A306354) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 3s.

Enlarge Image

Figure 2: Western Blot - Anti-IKZF3 Antibody [ARC2781] (A306354)

Western blot analysis of extracts of various cell lines, using Anti-IKZF3 Antibody [ARC2781] (A306354) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 60s.

Enlarge Image

Figure 3: Western Blot - Anti-IKZF3 Antibody [ARC2781] (A306354)

Western blot analysis of extracts of Rat lung, using Anti-IKZF3 Antibody [ARC2781] (A306354) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Enhanced Kit (RM00021). Exposure time: 90s.

Enlarge Image

Figure 4: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 5: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 6: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 7: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded rat lung using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 8: Immunohistochemistry - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 9: Immunofluorescence - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunofluorescence analysis of rat spleen using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Enlarge Image

Figure 10: Western Blot - Anti-IKZF3 Antibody [ARC2781] (A306354)

Immunoprecipitation analysis of 300µg extracts of Raji cells using 3µg of Anti-IKZF3 Antibody [ARC2781] (A306354). This Western blot was performed on the immunoprecipitate using Anti-IKZF3 Antibody [ARC2781] (A306354) at a dilution of 1:500.

Show more images

Publishing research using Anti-IKZF3 Antibody [ARC2781] (A306354)? Please let us know so that we can list the citation on this page.