+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-IL-17A Antibody [ARC52762] (A306037)

Immunohistochemistry - Anti-IL-17A Antibody [ARC52762] (A306037) - Antibodies.com Immunohistochemistry - Anti-IL-17A Antibody [ARC52762] (A306037) - Antibodies.com Immunohistochemistry - Anti-IL-17A Antibody [ARC52762] (A306037) - Antibodies.com Immunohistochemistry - Anti-IL-17A Antibody [ARC52762] (A306037) - Antibodies.com
$470
Product Datasheet

Rabbit monoclonal [ARC52762] antibody to IL-17A for IHC.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-IL-17A Antibody [ARC52762]
Description
Rabbit monoclonal [ARC52762] antibody to IL-17A.
Applications
IHC
Dilutions
IHC: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 24-155 of human IL17A (NP_002181.1).
Sequence
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Host
Rabbit
Clonality
Monoclonal
Clone ID
ARC52762
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
CTLA-8, CTLA8, Cytotoxic T-lymphocyte-associated antigen 8, IL-17, IL17, Il17a, IL17_HUMAN, Interleukin-17A
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Immunohistochemistry - Anti-IL-17A Antibody [ARC52762] (A306037) - Antibodies.comEnlarge Image
Figure 1: Immunohistochemistry - Anti-IL-17A Antibody [ARC52762] (A306037)
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-IL-17A Antibody [ARC52762] (A306037) at a dilution of 1:100(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-IL-17A Antibody [ARC52762] (A306037) - Antibodies.comEnlarge Image
Figure 2: Immunohistochemistry - Anti-IL-17A Antibody [ARC52762] (A306037)
Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-IL-17A Antibody [ARC52762] (A306037) at a dilution of 1:100(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-IL-17A Antibody [ARC52762] (A306037) - Antibodies.comEnlarge Image
Figure 3: Immunohistochemistry - Anti-IL-17A Antibody [ARC52762] (A306037)
Immunohistochemistry analysis of paraffin-embedded mouse colon using Anti-IL-17A Antibody [ARC52762] (A306037) at a dilution of 1:100(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-IL-17A Antibody [ARC52762] (A306037) - Antibodies.comEnlarge Image
Figure 4: Immunohistochemistry - Anti-IL-17A Antibody [ARC52762] (A306037)
Immunohistochemistry analysis of paraffin-embedded rat colon using Anti-IL-17A Antibody [ARC52762] (A306037) at a dilution of 1:100(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Publishing research using Anti-IL-17A Antibody [ARC52762] (A306037)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-IL-17A Antibody [ARC52762] (A306037)

SDS-PAGE - Vunakizumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free (A323840) - Antibodies.com
(2)
A323840
Vunakizumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A283801
Anti-IL-17A Antibody
Chicken polyclonal antibody to IL-17A for WB and ELISA.
SDS-PAGE - Secukinumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free (A323724) - Antibodies.com
(3)
A323724
Secukinumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-17A Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324080) - Antibodies.com
(2)
A324080
Anti-IL-17A Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-17A Antibody [CAT-2200] - Low endotoxin, Azide free (A324081) - Antibodies.com
(2)
A324081
Anti-IL-17A Antibody [CAT-2200] - Low endotoxin, Azide free
Recombinant human monoclonal [CAT-2200] antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A283405
Anti-IL-17A Antibody
Rabbit polyclonal antibody to IL-17A for WB and ELISA.
Western Blot - Anti-IL-17A Antibody (A89567) - Antibodies.com
(3)
A89567
Anti-IL-17A Antibody
Rabbit polyclonal antibody to IL-17A for WB and IHC.
SDS-PAGE - Netakimab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free (A323605) - Antibodies.com
(2)
A323605
Netakimab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Perakizumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free (A323660) - Antibodies.com
(2)
A323660
Perakizumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-17A Antibody [SY18-VHH-11] - Low endotoxin, Azide free (A324082) - Antibodies.com
(2)
A324082
Anti-IL-17A Antibody [SY18-VHH-11] - Low endotoxin, Azide free
Recombinant chimeric monoclonal [SY18-VHH-11] antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A283386
Anti-IL-17A Antibody
Rabbit polyclonal antibody to IL-17A for WB and ELISA.
SDS-PAGE - Ixekizumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free (A323522) - Antibodies.com
(2)
A323522
Ixekizumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Vunakizumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free (A323840) - Antibodies.com
(2)
A323840
Vunakizumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A283801
Anti-IL-17A Antibody
Chicken polyclonal antibody to IL-17A for WB and ELISA.
SDS-PAGE - Secukinumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free (A323724) - Antibodies.com
(3)
A323724
Secukinumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-17A Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free (A324080) - Antibodies.com
(2)
A324080
Anti-IL-17A Antibody [Research Grade Biosimilar] - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-17A Antibody [CAT-2200] - Low endotoxin, Azide free (A324081) - Antibodies.com
(2)
A324081
Anti-IL-17A Antibody [CAT-2200] - Low endotoxin, Azide free
Recombinant human monoclonal [CAT-2200] antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A283405
Anti-IL-17A Antibody
Rabbit polyclonal antibody to IL-17A for WB and ELISA.
Western Blot - Anti-IL-17A Antibody (A89567) - Antibodies.com
(3)
A89567
Anti-IL-17A Antibody
Rabbit polyclonal antibody to IL-17A for WB and IHC.
SDS-PAGE - Netakimab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free (A323605) - Antibodies.com
(2)
A323605
Netakimab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Perakizumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free (A323660) - Antibodies.com
(2)
A323660
Perakizumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-IL-17A Antibody [SY18-VHH-11] - Low endotoxin, Azide free (A324082) - Antibodies.com
(2)
A324082
Anti-IL-17A Antibody [SY18-VHH-11] - Low endotoxin, Azide free
Recombinant chimeric monoclonal [SY18-VHH-11] antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
Antibodies.com Image Placeholder - Discover more for less
A283386
Anti-IL-17A Antibody
Rabbit polyclonal antibody to IL-17A for WB and ELISA.
SDS-PAGE - Ixekizumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free (A323522) - Antibodies.com
(2)
A323522
Ixekizumab Biosimilar - Anti-IL-17A Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to IL-17A for ELISA, FACS, Functional Assay and In Vivo.
See all Anti-IL-17A Antibodies
Main Menu Contact Us 0Checkout
Top